Category: it

2012

Свежезафрендившим. Манифест.

Дорогие и уважаемые гг. свежезафрендившие!
В связи с вашим появлением (за которое спасибо Вам и всем причастным), должен сразу предупредить:

1. Я, ЖЖ-юзер wolk_off - очень древний (а я-человек, т.е. Кирилл Мошков - ещё более древний, но это в данном случае не так важно). В мае 2003 г. я пришёл в ещё англоязычный ЖЖ и ещё по "инвайту" (и даже помню, по чьему именно). С первого дня появления т.н. "кириллических сервисов" я наглухо от них отписан, и при этом я платный пользователь, т.е. входная страница у меня по-прежнему англоязычная, я не вижу внутри ЖЖ рекламы, не вижу ЖЖ-промо, не вижу LJ-Times, не играю в игры типа "социальный капитал" (видите, у меня даже нет этой опции - я её отключил), не вижу "популярных записей" (и имею честь не интересоваться ими) и т.п. Поэтому, если Вы как раз играете в игры типа "социальный капитал" и ищете продвижения на ЖЖ-рынке, я, увы, ничем не смогу быть Вам полезен.

2. Я предпочитаю оригинальный контент, и поэтому мой собственный журнал состоит преимущественно из постов, которые я написал сам. Не скопипастил, не перепостил и не скомпилировал из других источников, а написал сам. Да, такое бывает. И да, меня интересуют преимущественно посты, которые люди пишут сами, из головы. Если Ваш журнал страшно популярен, но состоит из того, что Вы скопипастили, перепостили и/или скомпилировали из внешних источников, - мне, к сожалению, будет неинтересно его читать. Следовательно, меня, к большому сожалению, не интересует взаимный френдёж как таковой - меня интересует формирование френдленты, которую мне интересно и/или полезно читать. В силу естественных процессов некоторые авторы иногда уходят из ЖЖ, а мне хочется читать насыщенную, не сокращающуюся френдленту, поэтому я френжу и буду френдить (вне зависимости от того, френдят ли меня в ответ, хотя такому обороту событий обычно радуюсь) - но в основном тех, кого мне самому интересно и важно читать.
Collapse )
Вот примерно таким образом. Простите, если что :)
Giggling

Кульные хацкеры ататат


Получаю письмо. Тут надо заметить, что письма у меня смотрятся не через браузер, а через специальный почтовый клиент, собирающий письма с нескольких адресов (рабочего, личного, запасного). В клиенте письма показываются строго как голый текст, никакого HTML. Поэтому ухищрения менее умелых кульных хацкеров, пытающихся захватить тот или иной принадлежащий мне сайт или доменное имя, видны как на ладони.

Отправитель: "R01.RU"
Тема: Необходима активация домена [один из моих доменов]

Текст: Collapse )
Что сразу бросается в глаза?
Что для показа в HTML адрес отправителя будет выглядеть как R01.RU, а это домен одного из регистраторов доменных имён. Но в действительности, как мы видим, настоящий адрес, с которого отправлено письмо - info@r01l.ru. Одна лишняя буква в доменном имени. А я же, видите ли, редактор. Мне лишние буквы полагается видеть.
Попытка же увидеть, что находится на домене r01l.ru, приводит... да ни к чему не приводит: ничего заслуживающего внимания там нет. Может так быть, если бы это был действительно сайт уважаемого официального регистратора доменов? Конечно, нет.

Оставим в стороне ещё и тот факт, что ни на какие рассылки R01.RU я не подписывался, мало того - домен, который тут у меня пытаются отжать, регистрировал через совсем другую контору.

В глаза бросается также то, что меня пытаются заставить положить в корень сайта исполняемый код. Да-да. Если на сайте есть поддержка php, то предлагаемый код будет выполнять любой запрос переменной [R01]. А в эту переменную можно ввести что угодно, включая программу захвата власти во Вселенной.

Другое дело, что на этом самом сайте никакой поддержки php нет, но это уже детали.

И ещё в глаза бросаются слова "фактическое управление доменом domain.ru". Тут у них должен был подставляться тот домен, управление которым они пытаются захватить. Но он у них не подставляется, потому что они криворукие. Так и шлётся письмо - с требованием подтвердить фактическое управление... совсем другим доменом, принадлежащим, в дополнение ко всему этому абсурду, другому регистратору доменов, компании SALENAMES!

При этом домен, который у меня пытаются отжать, у меня не один: у меня много других доменов, и я знаю, что подлинный регистратор доменных имён решает вопросы подтверждения владельца домена совсем-совсем другим способом - уж во всяком случае не посредством установки на соответствующие сайты исполняемого кода.

В общем, низачот вам, кульные хацкеры. Идите в пень.
2015

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch и др.

Люблю языковых кунштюков. Ими меня регулярно снабжает Artemio El Cubano, мой давний приятель Артем Прохоров. Вот один: длиннейшее доменное имя в мире. Кроме известного уэльского городка Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch, давшего этому домену свое непростое имя, на сайте перечислены и другие длинные названия городов по всему миру - в том числе мой любимый город в Новой Зеландии -
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu -
(92 буквы), внесенный в Гиннесс как город с самым длинным названием в мире, и не внесенный туда, но зато стошестидесятитрёхбуквенный таиландский населенный пункт (название которого, в силу очевидных причин, не помещается в одну строку, отчего я разбиваю его здесь натрое -
Krungthepmahanakornamornratanakosinmahintarayutthayama
hadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharna
mornphimarnavatarnsathitsakkattiyavisanukamprasit
.
2015

Бесплатная веб-почта в джазовом домене

Нет, еще пока не джаз. ру. Jazzmusic.org - звучит? Кириллицу поддерживает. Сайнап здесь - в правой колонке внизу возникает окошко насчет фри веб-бэйзд емейл. Еще предлагается домен jazzman, между прочим. Вдруг кому надо?
  • Current Music
    KCSM - Bay Area Jazz Station